PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 270aa    MW: 31376.6 Da    PI: 5.95
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476272.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.71.8e-141148340
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                    i+++  r+ tf kR++ ++KK +ELS+LCd+++++ii+
  XP_016476272.1 11 IQDHKTRKSTFQKRKACLIKKISELSILCDIKACMIIY 48
                    889999******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.114148IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-15159IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-20294IPR002100Transcription factor, MADS-box
CDDcd002663.16E-20284No hitNo description
PRINTSPR004046.0E-8323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-141149IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRSKINMEL IQDHKTRKST FQKRKACLIK KISELSILCD IKACMIIYEG YNCEEIWPND  60
PNEVQELINL YKNQPIEDRS KRENSLCSFL ENQKKKAEIK MAKLKKKIKT EKYPTWDSRF  120
NYLSEKELRN LAGVLEKKME NAKGKSEFLK SSRNINQEIW DYPELMDNFN QSNPQPISYM  180
DNQFFQELTA DFDQVISSTD HVNSMGILDN GQLSVGDYQF GNSDYMKIEA EDLLVNNGII  240
GSSSRMQPVE LNQYSFISSG STQMPYGYLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016476272.10.0PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLK4D6Y44e-77K4D6Y4_SOLLC; Uncharacterized protein
TrEMBLM1CN254e-77M1CN25_SOLTU; Uncharacterized protein
STRINGSolyc11g020320.1.11e-76(Solanum lycopersicum)
STRINGPGSC0003DMT4000710011e-76(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22590.26e-19AGAMOUS-like 87